From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: from sa-prd-fep-049.btinternet.com (mailomta12-sa.btinternet.com [213.120.69.18]) by sourceware.org (Postfix) with ESMTPS id 9BEAB3858C00 for ; Tue, 29 Nov 2022 21:37:40 +0000 (GMT) DMARC-Filter: OpenDMARC Filter v1.4.1 sourceware.org 9BEAB3858C00 Authentication-Results: sourceware.org; dmarc=none (p=none dis=none) header.from=dronecode.org.uk Authentication-Results: sourceware.org; spf=none smtp.mailfrom=dronecode.org.uk Received: from sa-prd-rgout-002.btmx-prd.synchronoss.net ([10.2.38.5]) by sa-prd-fep-049.btinternet.com with ESMTP id <20221129213739.VHOR6602.sa-prd-fep-049.btinternet.com@sa-prd-rgout-002.btmx-prd.synchronoss.net>; Tue, 29 Nov 2022 21:37:39 +0000 Authentication-Results: btinternet.com; auth=pass (PLAIN) smtp.auth=jonturney@btinternet.com; bimi=skipped X-SNCR-Rigid: 6139417C45BCC656 X-Originating-IP: [81.153.98.246] X-OWM-Source-IP: 81.153.98.246 (GB) X-OWM-Env-Sender: jonturney@btinternet.com X-VadeSecure-score: verdict=clean score=0/300, class=clean X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedvhedrtddugddtkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemuceutffkvffkuffjvffgnffgvefqofdpqfgfvfenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepkfffgggfuffvfhfhjggtgfesthejredttdefjeenucfhrhhomheplfhonhcuvfhurhhnvgihuceojhhonhdrthhurhhnvgihsegurhhonhgvtghouggvrdhorhhgrdhukheqnecuggftrfgrthhtvghrnhepffekiefgudejheetudeigfejledtleegleetkeduteeftdfffefhueefgfeutedtnecukfhppeekuddrudehfedrleekrddvgeeinecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghloheplgduledvrdduieekrddurddutdeingdpihhnvghtpeekuddrudehfedrleekrddvgeeipdhmrghilhhfrhhomhepjhhonhdrthhurhhnvgihsegurhhonhgvtghouggvrdhorhhgrdhukhdpnhgspghrtghpthhtohepvddprhgtphhtthhopeevhhhrihhsthhirghnrdfhrhgrnhhkvgesthdqohhnlhhinhgvrdguvgdprhgtphhtthhopegthihgfihinhdqrghpphhssegthihgfihinhdrtghomh X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean Received: from [192.168.1.106] (81.153.98.246) by sa-prd-rgout-002.btmx-prd.synchronoss.net (5.8.716.04) (authenticated as jonturney@btinternet.com) id 6139417C45BCC656; Tue, 29 Nov 2022 21:37:39 +0000 Message-ID: Date: Tue, 29 Nov 2022 21:37:39 +0000 MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101 Thunderbird/102.5.0 Subject: Re: [Bug] setup regression #2 Content-Language: en-GB To: "cygwin-apps@cygwin.com" , Christian Franke References: <87pmfn5o2j.fsf@Rainer.invalid> <0c8c757c-4f6b-3b49-5404-99353de48b1b@dronecode.org.uk> <877d1gd83r.fsf@Rainer.invalid> <3f6098ed-0b64-33f2-c8ca-36a92500adbb@dronecode.org.uk> <87pmf2p830.fsf@Rainer.invalid> <8a811ecf-38e7-a631-c09e-92ca4d439cc2@dronecode.org.uk> <87iljjggwl.fsf@Rainer.invalid> <87fsedla3u.fsf@Rainer.invalid> From: Jon Turney In-Reply-To: <87fsedla3u.fsf@Rainer.invalid> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spam-Status: No, score=-3570.0 required=5.0 tests=BAYES_00,FORGED_SPF_HELO,KAM_DMARC_STATUS,KAM_LAZY_DOMAIN_SECURITY,KAM_NUMSUBJECT,NICE_REPLY_A,RCVD_IN_DNSWL_NONE,SPF_HELO_PASS,SPF_NONE,TXREP autolearn=no autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on server2.sourceware.org List-Id: On 20/11/2022 19:05, Achim Gratz wrote: > Jon Turney writes: >> I believe that the intent of the code in setup is that there should >> only be two modes: >> >> USER: install "for me", with the users primary group > > As I understand it, the intention here was that the user can have a > "single user installation" in a place that they have access to (say, > their home directory) while they have no permission in one of the usual > places. In a setup where that place is a certain type of share the user > will not be able to change the group the files are owned by anyway > (standard NetApp CIFS shares are set up this way) and it may not be the > users primary group. > >> SYSTEM: install "for everyone", with the administrators primary group >> (only permitted if you are an administrator) > > I don't see why the fact the installation is meant to be used by > multiple users means that the install must be owned by group > Administrators. I'm not sure this is a good idea on Windows anyway, at > least when you don't put extra (inheritable) DACL on the install > folder. Christian, Maybe you can offer your opinion here, since you seem to have the opposite, or at least a different, point of view. > I've never tried installing into the usual place (%ProgramFiles%) as > that means that Windows enforces a number of rules that are different > from Cygwin's and change non-domain vs. in-domain machines, applied GPO > etc. > > So I'd really just introduce another parameter to specify what the group > the installer uses should be and have the default depend on whether the > user doing the install has administrative rights or not. A warning > should be issued when that group is different from the existing root > directory and of course the whole install should abort if the requested > group can't be made primary.