From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: from smtpout01-ext1.partage.renater.fr (smtpout01-ext1.partage.renater.fr [194.254.240.32]) by sourceware.org (Postfix) with ESMTP id 858893858D3C for ; Thu, 16 Sep 2021 10:48:54 +0000 (GMT) DMARC-Filter: OpenDMARC Filter v1.4.1 sourceware.org 858893858D3C Authentication-Results: sourceware.org; dmarc=none (p=none dis=none) header.from=oca.eu Authentication-Results: sourceware.org; spf=pass smtp.mailfrom=oca.eu Received: from zmtaauth01.partage.renater.fr (zmtaauth01.partage.renater.fr [194.254.240.25]) by smtpout10.partage.renater.fr (Postfix) with ESMTP id CACB962399 for ; Thu, 16 Sep 2021 12:48:51 +0200 (CEST) Received: from zmtaauth01.partage.renater.fr (localhost [127.0.0.1]) by zmtaauth01.partage.renater.fr (Postfix) with ESMTPS id EFDA914068C for ; Thu, 16 Sep 2021 12:48:50 +0200 (CEST) Received: from localhost (localhost [127.0.0.1]) by zmtaauth01.partage.renater.fr (Postfix) with ESMTP id E7D2614067E for ; Thu, 16 Sep 2021 12:48:50 +0200 (CEST) X-Virus-Scanned: amavisd-new at zmtaauth01.partage.renater.fr Received: from zmtaauth01.partage.renater.fr ([127.0.0.1]) by localhost (zmtaauth01.partage.renater.fr [127.0.0.1]) (amavisd-new, port 10026) with ESMTP id POgNsfjXE1dw for ; Thu, 16 Sep 2021 12:48:50 +0200 (CEST) Received: from [192.168.108.254] (unknown [194.254.241.249]) by zmtaauth01.partage.renater.fr (Postfix) with ESMTPA id 1C2A414069F for ; Thu, 16 Sep 2021 12:41:32 +0200 (CEST) Reply-To: Damien.MATTEI@univ-cotedazur.fr Subject: Re: define-syntax can only be used with local variables To: kawa@sourceware.org References: <2141982858.217799834.1631786557791.JavaMail.root@zimbra65-e11.priv.proxad.net> From: Damien MATTEI Message-ID: Date: Thu, 16 Sep 2021 12:41:31 +0200 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.13.0 MIME-Version: 1.0 In-Reply-To: <2141982858.217799834.1631786557791.JavaMail.root@zimbra65-e11.priv.proxad.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US X-Renater-Ptge-SpamState: clean X-Renater-Ptge-SpamScore: 0 X-Renater-Ptge-SpamCause: gggruggvucftvghtrhhoucdtuddrgedvtddrudehgedgvdejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecutffgpfetvffgtfenuceurghilhhouhhtmecufedttdenucenucfjughrpehruffvfhfhkffffgggjggtgfesthekredttdefjeenucfhrhhomhepffgrmhhivghnucfotefvvffgkfcuoegurghmihgvnhdrmhgrthhtvghisehotggrrdgvuheqnecuggftrfgrthhtvghrnhepheevvdekvdfhfeeiheevveetgefgvdektdehueeffeeigfejheeviedvffekgfehnecuffhomhgrihhnpehsthgrtghkohhvvghrfhhlohifrdgtohhmnecukfhppeduleegrddvheegrddvgedurddvgeelnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelgedrvdehgedrvdeguddrvdegledphhgvlhhopegludelvddrudeikedruddtkedrvdehgegnpdhmrghilhhfrhhomhepffgrmhhivghnucfotefvvffgkfcuoegurghmihgvnhdrmhgrthhtvghisehotggrrdgvuheqpdhrtghpthhtohepkhgrfigrsehsohhurhgtvgifrghrvgdrohhrgh Content-Transfer-Encoding: quoted-printable X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00, BODY_8BITS, KAM_DMARC_STATUS, NICE_REPLY_A, RCVD_IN_DNSWL_LOW, RCVD_IN_MSPIKE_H3, RCVD_IN_MSPIKE_WL, SPF_HELO_NONE, SPF_PASS, TXREP autolearn=ham autolearn_force=no version=3.4.4 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on server2.sourceware.org X-BeenThere: kawa@sourceware.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Kawa mailing list List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 16 Sep 2021 10:48:57 -0000 but why is it working with one version of kawa and not another? or did i=20 missed something in discussion? Damien Le 16/09/2021 =C3=A0 12:02, phiroc--- via Kawa a =C3=A9crit=C2=A0: > Hello, > here's an explanation : > > "The statement (set! *myglobal* "This does not") is executed in the tra= nsformer environment, not the normal environment. So it's not able to fin= d *myglobal. We need to get both the expressions executed in the environm= ent where *myglobal* is defined." > > cf. https://stackoverflow.com/questions/5509837/set-global-from-scheme-= macro > > > > ----- Mail original ----- > De: "phiroc--- via Kawa" > =C3=80: kawa@sourceware.org > Envoy=C3=A9: Mercredi 15 Septembre 2021 09:10:15 > Objet: Re: define-syntax can only be used with local variables > > Good morning, > on Windows 10, using Kawa 3.1.1 and JDK 1.8.0_191, (nil2! y) fails to s= et y to '(0). > Hence, there's probably a bug in the Kawa code (unless, in Scheme, macr= os are not supposed to set dynamic variables). > Best regards, > Philippe > > ----------------------------------------------- > > > > > (define-syntax nil2! > (syntax-rules () > ((_ x) > (set! x '(0))))) > > (define y '(1)) > (nil2! y) > (display y) (newline) > > > > > ----- Mail original ----- > De: "Per Bothner" > =C3=80: "Damien MATTEI" > Cc: kawa@sourceware.org > Envoy=C3=A9: Mardi 14 Septembre 2021 21:30:55 > Objet: Re: define-syntax can only be used with local variables > > > > On 9/14/21 11:38 AM, Damien Mattei wrote: >> message of compiler is big, here is a part: >> >> (for f in kawa/standard/SchemeScriptEngineFactory.java kawa/GuiConsole= .java kawa/GuiInPort.java kawa/ReplPane.java kawa/ReplDocument.java kawa/= ReplPaneOutPort.java gnu/kawa/models/Box.java gnu/kawa/models/Button.java= gnu/kawa/models/Column.java gnu/kawa/models/DDimension.java gnu/kawa/mod= els/Display.java gnu/kawa/models/DrawImage.java gnu/kawa/models/DrawShape= .java gnu/kawa/models/FillShape.java gnu/kawa/models/Label.java gnu/kawa/= models/Model.java gnu/kawa/models/ModelListener.java gnu/kawa/models/Menu= Item.java gnu/kawa/models/Picture.java gnu/kawa/models/Pictures.java gnu/= kawa/models/PictureToSvg.java gnu/kawa/models/PictureVisitor.java gnu/kaw= a/models/PBox.java gnu/kawa/models/Row.java gnu/kawa/models/Spacer.java g= nu/kawa/models/StandardColor.java gnu/kawa/models/SVGUtils.java gnu/kawa/= models/Text.java gnu/kawa/models/Viewable.java gnu/kawa/models/WeakListen= er.java gnu/kawa/models/Window.java gnu/kawa/models/WithComposite.java gn= u/kawa/models/WithPaint.java >> gnu/kawa/models/WithTransform.java=C2=A0 ; do echo ./$f; done) >>tmp-l= ist >> mv tmp-list tmp-sources1.list >> javac -d . -classpath ".:.:$CLASSPATH" -g @tmp-sources1.list >> ./gnu/lists/CharSeq.java:11: error: types CharSequence and Sequence= are incompatible; >> public interface CharSeq >> =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 ^ >> =C2=A0 interface CharSeq inherits abstract and default for isEmpty()= from types CharSequence and Sequence >> =C2=A0 where E is a type-variable: >> =C2=A0=C2=A0=C2=A0 E extends Object declared in interface Sequence > I'm trying the latest (gitlab) Kawa with the JDK 17 (general release to= day). > I'm not seeing this error. I'm seeing the warnings, most of which seem= to > be easily fixable (by using 'Integer.valueOf' instead of 'new Integer' = etc); > I'm working on those now. >